MHCflurry predicts which peptides are likely to be displayed by MHC class I molecules. It provides pretrained models for three related tasks:
- Binding affinity: how strongly a peptide binds an MHC allele.
- Antigen processing: whether cellular processing favors the peptide.
- Presentation: a combined score using binding and processing predictions.
You can use the released models from the command line or Python, scan proteins for candidate epitopes, or train models on your own data.
Install MHCflurry, including prereleases, and download the pretrained presentation models:
pip install --upgrade --pre mhcflurry
mhcflurry downloads fetch models_class1_presentationOmit --pre to install the latest stable release.
Predict a few peptides:
mhcflurry predict \
--alleles HLA-A0201 HLA-A0301 \
--peptides SIINFEKL SIINFEKD SIINFEKQ \
--out predictions.csvOr scan a protein sequence for candidate ligands:
mhcflurry predict-scan \
--sequences MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHS \
--alleles 'HLA-A*02:01' \
--out scan.csvTo try MHCflurry without installing anything, open the Colab notebook.
The historical mhcflurry-* command names remain supported for existing
scripts. See the 2.3.0 release notes for details.
- Introduction and installation
- Command-line tutorial
- Python tutorial
- Training models
- Command reference
- API reference
Please file an issue if you have questions or encounter problems.
If you use MHCflurry in your research, please cite:
T. O'Donnell, A. Rubinsteyn, U. Laserson. "MHCflurry 2.0: Improved pan-allele prediction of MHC I-presented peptides by incorporating antigen processing," Cell Systems, 2020. https://doi.org/10.1016/j.cels.2020.06.010
T. O'Donnell, A. Rubinsteyn, M. Bonsack, A. B. Riemer, U. Laserson, and J. Hammerbacher, "MHCflurry: Open-Source Class I MHC Binding Affinity Prediction," Cell Systems, 2018. https://doi.org/10.1016/j.cels.2018.05.014
Contributions are welcome. Start with CONTRIBUTING.md; the testing guide describes the fast local checks and full suite.
Run the latest image from Docker Hub:
docker run -p 9999:9999 --rm openvax/mhcflurry:latestThen open http://localhost:9999 to use the included Jupyter environment. To
build the image from a checkout:
docker build -t mhcflurry:latest .
docker run -p 9999:9999 --rm mhcflurry:latest